OLFML2A antibody (70R-4200)

Rabbit polyclonal OLFML2A antibody raised against the N terminal of OLFML2A

Synonyms Polyclonal OLFML2A antibody, Anti-OLFML2A antibody, OLFMLA-2 antibody, OLFMLA-2, OLFMLA 2 antibody, OLFML2A, OLFMLA 2, Olfactomedin-Like 2A antibody, PRO34319 antibody, FLJ00237 antibody
Specificity OLFML2A antibody was raised against the N terminal of OLFML2A
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen OLFML2A antibody was raised using the N terminal of OLFML2A corresponding to a region with amino acids EDFYTVETVSSGTDCRCSCTAPPSSLNPCENEWKMEKLKKQAPELLKLQS
Assay Information OLFML2A Blocking Peptide, catalog no. 33R-2311, is also available for use as a blocking control in assays to test for specificity of this OLFML2A antibody


Western Blot analysis using OLFML2A antibody (70R-4200)

OLFML2A antibody (70R-4200) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 73 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of OLFML2A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The exact function of OLFML2A is not known.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using OLFML2A antibody (70R-4200) | OLFML2A antibody (70R-4200) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors