OLFML2B antibody (70R-6458)

Rabbit polyclonal OLFML2B antibody raised against the N terminal of OLFML2B

Synonyms Polyclonal OLFML2B antibody, Anti-OLFML2B antibody, Olfactomedin-Like 2B antibody, OLFML2B, OLFMLB-2 antibody, OLFMLB 2, OLFMLB 2 antibody, OLFMLB-2, RP11-227F8.1 antibody, MGC51337 antibody
Specificity OLFML2B antibody was raised against the N terminal of OLFML2B
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen OLFML2B antibody was raised using the N terminal of OLFML2B corresponding to a region with amino acids EEVSKNLTKENEQIKEDMEEIRTEMNKRGKENCSENILDSMPDIRSALQR
Assay Information OLFML2B Blocking Peptide, catalog no. 33R-2397, is also available for use as a blocking control in assays to test for specificity of this OLFML2B antibody

Images

Western Blot analysis using OLFML2B antibody (70R-6458)

OLFML2B antibody (70R-6458) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 84 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of OLFML2B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of OLFML2B protein has not been widely studied, and is yet to be fully elucidated.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using OLFML2B antibody (70R-6458) | OLFML2B antibody (70R-6458) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors