OMA1 antibody (70R-4466)

Rabbit polyclonal OMA1 antibody

Synonyms Polyclonal OMA1 antibody, Anti-OMA1 antibody, FLJ33782 antibody, OMA-1, OMA1, ZMPOMA1 antibody, MPRP-1 antibody, Oma1 Homolog Zinc Metallopeptidase antibody, DAB1 antibody, YKR087C antibody, OMA 1 antibody, OMA 1, 2010001O09Rik antibody, OMA-1 antibody
Cross Reactivity Human
Applications WB
Immunogen OMA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids WAICPRDSLALLCQWIQSKLQEYMFNRPYSRKLEAEADKIGLLLAAKACA
Assay Information OMA1 Blocking Peptide, catalog no. 33R-9932, is also available for use as a blocking control in assays to test for specificity of this OMA1 antibody

Images

Western Blot analysis using OMA1 antibody (70R-4466)

OMA1 antibody (70R-4466) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 60 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of OMA1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance OMA1 is a mitochondrial protease.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using OMA1 antibody (70R-4466) | OMA1 antibody (70R-4466) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors