OMG antibody (70R-6384)

Rabbit polyclonal OMG antibody raised against the N terminal of OMG

Synonyms Polyclonal OMG antibody, Anti-OMG antibody, Oligodendrocyte Myelin Glycoprotein antibody, OMGP antibody
Specificity OMG antibody was raised against the N terminal of OMG
Cross Reactivity Human
Applications WB
Immunogen OMG antibody was raised using the N terminal of OMG corresponding to a region with amino acids ANNNIKLLDKSDTAYQWNLKYLDVSKNMLEKVVLIKNTLRSLEVLNLSSN
Assay Information OMG Blocking Peptide, catalog no. 33R-1403, is also available for use as a blocking control in assays to test for specificity of this OMG antibody

Images

Western Blot analysis using OMG antibody (70R-6384)

OMG antibody (70R-6384) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 49 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of OMG antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance OMG is a cell adhesion molecule contributing to the interactive process required for myelination in the central nervous system.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using OMG antibody (70R-6384) | OMG antibody (70R-6384) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors