OMG antibody (70R-6385)

Rabbit polyclonal OMG antibody raised against the middle region of OMG

Synonyms Polyclonal OMG antibody, Anti-OMG antibody, OMGP antibody, Oligodendrocyte Myelin Glycoprotein antibody
Specificity OMG antibody was raised against the middle region of OMG
Cross Reactivity Human
Applications WB
Immunogen OMG antibody was raised using the middle region of OMG corresponding to a region with amino acids NTLRSLEVLNLSSNKLWTVPTNMPSKLHIVDLSNNSLTQILPGTLINLTN
Assay Information OMG Blocking Peptide, catalog no. 33R-6901, is also available for use as a blocking control in assays to test for specificity of this OMG antibody

Images

Western Blot analysis using OMG antibody (70R-6385)

OMG antibody (70R-6385) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 49 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of OMG antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance OMG is a cell adhesion molecule contributing to the interactive process required for myelination in the central nervous system.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using OMG antibody (70R-6385) | OMG antibody (70R-6385) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors