OR11H12 antibody (70R-6537)

Rabbit polyclonal OR11H12 antibody raised against the N terminal of OR11H12

Synonyms Polyclonal OR11H12 antibody, Anti-OR11H12 antibody, ORH12 11 antibody, Olfactory Receptor Family 11 Subfamily H Member 12 antibody, ORH12-11, ORH12 11, ORH12-11 antibody, OR11H12
Specificity OR11H12 antibody was raised against the N terminal of OR11H12
Cross Reactivity Human
Applications WB
Immunogen OR11H12 antibody was raised using the N terminal of OR11H12 corresponding to a region with amino acids CPLTLQVTGLMNVSEPNSSFAFVNEFILQGFTCEWTIQIFLFSLFTTTYA
Assay Information OR11H12 Blocking Peptide, catalog no. 33R-1768, is also available for use as a blocking control in assays to test for specificity of this OR11H12 antibody

Images

Western Blot analysis using OR11H12 antibody (70R-6537)

OR11H12 antibody (70R-6537) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of OR11H12 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using OR11H12 antibody (70R-6537) | OR11H12 antibody (70R-6537) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors