OR5T2 antibody (70R-6531)

Rabbit polyclonal OR5T2 antibody raised against the C terminal of OR5T2

Synonyms Polyclonal OR5T2 antibody, Anti-OR5T2 antibody, ORT2 5, ORT2-5, ORT2 5 antibody, OR11-177 antibody, Olfactory Receptor Family 5 Subfamily T Member 2 antibody, OR5T2, ORT2-5 antibody
Specificity OR5T2 antibody was raised against the C terminal of OR5T2
Cross Reactivity Human
Applications WB
Immunogen OR5T2 antibody was raised using the C terminal of OR5T2 corresponding to a region with amino acids DMIVSIFYTIVIPLLNPVIYSLRNKDVKDSMKKMFGKNQVINKVYFHTKK
Assay Information OR5T2 Blocking Peptide, catalog no. 33R-2075, is also available for use as a blocking control in assays to test for specificity of this OR5T2 antibody

Images

Western Blot analysis using OR5T2 antibody (70R-6531)

OR5T2 antibody (70R-6531) used at 0.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of OR5T2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using OR5T2 antibody (70R-6531) | OR5T2 antibody (70R-6531) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors