OR6C68 antibody (70R-6774)

Rabbit polyclonal OR6C68 antibody raised against the N terminal of OR6C68

Synonyms Polyclonal OR6C68 antibody, Anti-OR6C68 antibody, ORC8-6 antibody, ORC8 6 antibody, OR6C68, ORC8-6, Olfactory Receptor Family 6 Subfamily C Member 68 antibody, ORC8 6
Specificity OR6C68 antibody was raised against the N terminal of OR6C68
Cross Reactivity Human
Applications WB
Immunogen OR6C68 antibody was raised using the N terminal of OR6C68 corresponding to a region with amino acids MQKSVMRKHTAITTFILLGLTEDPQLQVLLFMFLFITYMLSVTGKLTIIA
Assay Information OR6C68 Blocking Peptide, catalog no. 33R-6330, is also available for use as a blocking control in assays to test for specificity of this OR6C68 antibody

Images

Western Blot analysis using OR6C68 antibody (70R-6774)

OR6C68 antibody (70R-6774) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of OR6C68 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using OR6C68 antibody (70R-6774) | OR6C68 antibody (70R-6774) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors