OR6C75 antibody (70R-6259)

Rabbit polyclonal OR6C75 antibody raised against the middle region of OR6C75

Synonyms Polyclonal OR6C75 antibody, Anti-OR6C75 antibody, ORC75 6 antibody, OR6C75, ORC75 6, Olfactory Receptor Family 6 Subfamily C Member 75 antibody, ORC75-6, ORC75-6 antibody
Specificity OR6C75 antibody was raised against the middle region of OR6C75
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen OR6C75 antibody was raised using the middle region of OR6C75 corresponding to a region with amino acids SCIFMYIKTSARERVTLSKGVAVLNTSVAPLLNPFIYTLRNKQVKQAFKS
Assay Information OR6C75 Blocking Peptide, catalog no. 33R-8330, is also available for use as a blocking control in assays to test for specificity of this OR6C75 antibody

Images

Western Blot analysis using OR6C75 antibody (70R-6259)

OR6C75 antibody (70R-6259) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of OR6C75 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using OR6C75 antibody (70R-6259) | OR6C75 antibody (70R-6259) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors