ORAI1 antibody (70R-6426)

Rabbit polyclonal ORAI1 antibody raised against the middle region of ORAI1

Synonyms Polyclonal ORAI1 antibody, Anti-ORAI1 antibody, CRACM1 antibody, ORAI1, FLJ14466 antibody, ORAI-1 antibody, TMEM142A antibody, ORAI-1, ORAI 1 antibody, Orai Calcium Release-Activated Calcium Modulator 1 antibody, ORAI 1
Specificity ORAI1 antibody was raised against the middle region of ORAI1
Cross Reactivity Human
Applications WB
Immunogen ORAI1 antibody was raised using the middle region of ORAI1 corresponding to a region with amino acids IGTLLFLAEVVLLCWVKFLPLKKQPGQPRPTSKPPASGAAANVSTSGITP
Assay Information ORAI1 Blocking Peptide, catalog no. 33R-3979, is also available for use as a blocking control in assays to test for specificity of this ORAI1 antibody

Images

Western Blot analysis using ORAI1 antibody (70R-6426)

ORAI1 antibody (70R-6426) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ORAI1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ORAI1 belongs to the Orai family. ORAI1 (CRACM1) is a plasma membrane protein essential for store-operated calcium entry. Defects in ORAI1 are a cause of severe combined immunodeficiency with CRAC channel dysfunction.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ORAI1 antibody (70R-6426) | ORAI1 antibody (70R-6426) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors