ORAI2 antibody (70R-6919)

Rabbit polyclonal ORAI2 antibody raised against the middle region of ORAI2

Synonyms Polyclonal ORAI2 antibody, Anti-ORAI2 antibody, FLJ12474 antibody, FLJ14733 antibody, TMEM142B antibody, C7orf19 antibody, Orai Calcium Release-Activated Calcium Modulator 2 antibody, CBCIP2 antibody, ORAI-2, ORAI2, ORAI-2 antibody, ORAI 2 antibody, ORAI 2
Specificity ORAI2 antibody was raised against the middle region of ORAI2
Cross Reactivity Human
Applications WB
Immunogen ORAI2 antibody was raised using the middle region of ORAI2 corresponding to a region with amino acids IELAWGFSTVLGILLFLAEVVLLCWIKFLPVDARRQPGPPPGPGSHTGWQ
Assay Information ORAI2 Blocking Peptide, catalog no. 33R-3944, is also available for use as a blocking control in assays to test for specificity of this ORAI2 antibody

Images

Western Blot analysis using ORAI2 antibody (70R-6919)

ORAI2 antibody (70R-6919) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 28 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ORAI2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ORAI2 is a multi-pass membrane protein, and it belongs to the Orai family. It is a Ca(2+) release-activated Ca(2+)-like (CRAC-like) channel subunit which mediates Ca(2+) influx and increase in Ca(2+)-selective current by synergy with the Ca(2+) sensor, STIM1.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ORAI2 antibody (70R-6919) | ORAI2 antibody (70R-6919) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors