ORC4L antibody (70R-5589)

Rabbit polyclonal ORC4L antibody

Synonyms Polyclonal ORC4L antibody, Anti-ORC4L antibody, ORCL 4, ORCL-4 antibody, ORCL-4, ORC4L, ORCL 4 antibody, ORC4 antibody, Origin Recognition Complex Subunit 4-Like antibody, ORC4P antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ORC4L antibody was raised using a synthetic peptide corresponding to a region with amino acids VLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFVQRKAHSVYNFEKPVV
Assay Information ORC4L Blocking Peptide, catalog no. 33R-9651, is also available for use as a blocking control in assays to test for specificity of this ORC4L antibody


Western Blot analysis using ORC4L antibody (70R-5589)

ORC4L antibody (70R-5589) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 50 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ORC4L antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The origin recognition complex (ORC) is a highly conserved six subunit protein complex essential for the initiation of the DNA replication in eukaryotic cells.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ORC4L antibody (70R-5589) | ORC4L antibody (70R-5589) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors