ORC6L antibody (70R-5606)

Rabbit polyclonal ORC6L antibody

Synonyms Polyclonal ORC6L antibody, Anti-ORC6L antibody, ORC6 antibody, ORCL 6, ORCL-6, ORC6L, ORCL 6 antibody, Origin Recognition Complex Subunit 6 Like antibody, ORCL-6 antibody
Cross Reactivity Human
Applications WB
Immunogen ORC6L antibody was raised using a synthetic peptide corresponding to a region with amino acids VEAPAKEMEKVEEMPHKPQKDEDLTQDYEEWKRKILENAASAQKATAE
Assay Information ORC6L Blocking Peptide, catalog no. 33R-9488, is also available for use as a blocking control in assays to test for specificity of this ORC6L antibody


Western Blot analysis using ORC6L antibody (70R-5606)

ORC6L antibody (70R-5606) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 28 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ORC6L antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The origin recognition complex (ORC) is a highly conserved six subunit protein complex essential for the initiation of the DNA replication in eukaryotic cells. Studies in yeast demonstrated that ORC binds specifically to origins of replication and serves as a platform for the assembly of additional initiation factors such as Cdc6 and Mcm proteins. ORC6L is a subunit of the ORC complex. It has been shown that this protein and and ORC1L are loosely associated with the core complex consisting of ORC2L, -3L, -4L and -5L. gene silencing.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ORC6L antibody (70R-5606) | ORC6L antibody (70R-5606) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors