OSBPL1A antibody (70R-4070)

Rabbit polyclonal OSBPL1A antibody raised against the middle region of OSBPL1A

Synonyms Polyclonal OSBPL1A antibody, Anti-OSBPL1A antibody, OSBPLA-1 antibody, OSBPLA 1 antibody, OSBPLA-1, OSBPL1B antibody, Oxysterol Binding Protein-Like 1A antibody, OSBPL1A, FLJ10217 antibody, ORP1 antibody, OSBPLA 1, ORP-1 antibody
Specificity OSBPL1A antibody was raised against the middle region of OSBPL1A
Cross Reactivity Human
Applications WB
Immunogen OSBPL1A antibody was raised using the middle region of OSBPL1A corresponding to a region with amino acids EGEHLGSRKHRMSEEKDCGGGDALSNGIKKHRTSLPSPMFSRNDFSIWSI
Assay Information OSBPL1A Blocking Peptide, catalog no. 33R-2425, is also available for use as a blocking control in assays to test for specificity of this OSBPL1A antibody


Western Blot analysis using OSBPL1A antibody (70R-4070)

OSBPL1A antibody (70R-4070) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 108 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of OSBPL1A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Most members contain an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain, although some members contain only the sterol-binding domain. Transcript variants derived from alternative promoter usage and/or alternative splicing exist; they encode different isoforms.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using OSBPL1A antibody (70R-4070) | OSBPL1A antibody (70R-4070) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors