OSBPL8 antibody (70R-6725)

Rabbit polyclonal OSBPL8 antibody raised against the N terminal of OSBPL8

Synonyms Polyclonal OSBPL8 antibody, Anti-OSBPL8 antibody, OSBP10 antibody, MST120 antibody, OSBPL-8, MSTP120 antibody, DKFZp686A11164 antibody, OSBPL8, ORP8 antibody, OSBPL 8, MGC133203 antibody, MGC126578 antibody, OSBPL 8 antibody, OSBPL-8 antibody, Oxysterol Binding Protein-Like 8 antibody
Specificity OSBPL8 antibody was raised against the N terminal of OSBPL8
Cross Reactivity Human
Applications WB
Immunogen OSBPL8 antibody was raised using the N terminal of OSBPL8 corresponding to a region with amino acids SQRQGKEAYPTPTKDLHQPSLSPASPHSQGFERGKEDISQNKDESSLSMS
Assay Information OSBPL8 Blocking Peptide, catalog no. 33R-8722, is also available for use as a blocking control in assays to test for specificity of this OSBPL8 antibody

Images

Western Blot analysis using OSBPL8 antibody (70R-6725)

OSBPL8 antibody (70R-6725) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 97 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of OSBPL8 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance OSBPL8 is a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Like most members, OSBPL8 contains an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using OSBPL8 antibody (70R-6725) | OSBPL8 antibody (70R-6725) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors