OSGEP antibody (70R-3839)

Rabbit polyclonal OSGEP antibody raised against the middle region of OSGEP

Synonyms Polyclonal OSGEP antibody, Anti-OSGEP antibody, KAE1 antibody, OSGEP1 antibody, O-Sialoglycoprotein Endopeptidase antibody, PRSMG1 antibody, GCPL1 antibody, FLJ20411 antibody
Specificity OSGEP antibody was raised against the middle region of OSGEP
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen OSGEP antibody was raised using the middle region of OSGEP corresponding to a region with amino acids EHRYRIFGETIDIAVGNCLDRFARVLKISNDPSPGYNIEQMAKRGKKLVE
Assay Information OSGEP Blocking Peptide, catalog no. 33R-2460, is also available for use as a blocking control in assays to test for specificity of this OSGEP antibody


Western Blot analysis using OSGEP antibody (70R-3839)

OSGEP antibody (70R-3839) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of OSGEP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance O-sialoglycoprotein endopeptidases specifically cleave the polypeptide backbone of membrane glycoproteins that contain clusters of O-linked sialoglycans.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using OSGEP antibody (70R-3839) | OSGEP antibody (70R-3839) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors