OSGIN1 antibody (70R-6203)

Rabbit polyclonal OSGIN1 antibody raised against the N terminal of OSGIN1

Synonyms Polyclonal OSGIN1 antibody, Anti-OSGIN1 antibody, OSGIN1, OSGIN-1, BDGI antibody, OSGIN 1 antibody, OSGIN-1 antibody, OKL38 antibody, OSGIN 1, Oxidative Stress Induced Growth Inhibitor 1 antibody
Specificity OSGIN1 antibody was raised against the N terminal of OSGIN1
Cross Reactivity Human
Applications WB
Immunogen OSGIN1 antibody was raised using the N terminal of OSGIN1 corresponding to a region with amino acids APGVSILDQDLDYLSEGLEGRSQSPVALLFDALLRPDTDFGGNMKSVLTW
Assay Information OSGIN1 Blocking Peptide, catalog no. 33R-1422, is also available for use as a blocking control in assays to test for specificity of this OSGIN1 antibody

Images

Western Blot analysis using OSGIN1 antibody (70R-6203)

OSGIN1 antibody (70R-6203) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 61 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of OSGIN1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance OSGIN1 regulates the differentiation and proliferation of normal cells through the regulation of cell death.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using OSGIN1 antibody (70R-6203) | OSGIN1 antibody (70R-6203) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors