OSMR antibody (70R-7384)

Rabbit polyclonal OSMR antibody raised against the N terminal of OSMR

Synonyms Polyclonal OSMR antibody, Anti-OSMR antibody, MGC150627 antibody, OSMRB antibody, MGC75127 antibody, MGC150626 antibody, Oncostatin M Receptor antibody
Specificity OSMR antibody was raised against the N terminal of OSMR
Cross Reactivity Human
Applications WB
Immunogen OSMR antibody was raised using the N terminal of OSMR corresponding to a region with amino acids YQSEVLAERLPLTPVSLKVSTNSTRQSLHLQWTVHNLPYHQELKMVFQIQ
Assay Information OSMR Blocking Peptide, catalog no. 33R-10217, is also available for use as a blocking control in assays to test for specificity of this OSMR antibody

Images

Western Blot analysis using OSMR antibody (70R-7384)

OSMR antibody (70R-7384) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 110 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of OSMR antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Oncostatin M is a member of the IL6 family of cytokines. Functional receptors for IL6 family cytokines are multisubunit complexes involving members of the hematopoietin receptor superfamily. Many IL6 cytokines utilize gp130 as a common receptor subunit. OSM binds to the gp130 receptor subunit and, in association with the leukemia inhibitory factor receptor, induces a proliferative response in permissive cells.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using OSMR antibody (70R-7384) | OSMR antibody (70R-7384) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors