OSMR antibody (70R-7385)

Rabbit polyclonal OSMR antibody raised against the middle region of OSMR

Synonyms Polyclonal OSMR antibody, Anti-OSMR antibody, MGC150627 antibody, Oncostatin M Receptor antibody, OSMRB antibody, MGC75127 antibody, MGC150626 antibody
Specificity OSMR antibody was raised against the middle region of OSMR
Cross Reactivity Human
Applications WB
Immunogen OSMR antibody was raised using the middle region of OSMR corresponding to a region with amino acids LLEKKTGYSQELAPSDNPHVLVDTLTSHSFTLSWKDYSTESQPGFIQGYH
Assay Information OSMR Blocking Peptide, catalog no. 33R-5130, is also available for use as a blocking control in assays to test for specificity of this OSMR antibody

Images

Western Blot analysis using OSMR antibody (70R-7385)

OSMR antibody (70R-7385) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 110 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of OSMR antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Oncostatin M is a member of the IL6 family of cytokines. Functional receptors for IL6 family cytokines are multisubunit complexes involving members of the hematopoietin receptor superfamily. Many IL6 cytokines utilize gp130 as a common receptor subunit. OSM binds to the gp130 receptor subunit and, in association with the leukemia inhibitory factor receptor, induces a proliferative response in permissive cells.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using OSMR antibody (70R-7385) | OSMR antibody (70R-7385) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors