OSTalpha antibody (70R-4593)

Rabbit polyclonal OSTalpha antibody raised against the middle region of OSTalpha

Synonyms Polyclonal OSTalpha antibody, Anti-OSTalpha antibody, MGC39807 antibody, Organic Solute Transporter Alpha antibody
Specificity OSTalpha antibody was raised against the middle region of OSTalpha
Cross Reactivity Human
Applications WB
Immunogen OSTalpha antibody was raised using the middle region of OSTalpha corresponding to a region with amino acids LLMLGPFQYAFLKITLTLVGLFLVPDGIYDPADISEGSTALWINTFLGVS
Assay Information OSTalpha Blocking Peptide, catalog no. 33R-5169, is also available for use as a blocking control in assays to test for specificity of this OSTalpha antibody


Western Blot analysis using OSTalpha antibody (70R-4593)

OSTalpha antibody (70R-4593) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 38 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of OSTalpha antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance OSTalpha is essential component of the Ost-alpha/Ost-beta complex, a heterodimer that acts as the intestinal basolateral transporter responsible for bile acid export from enterocytes into portal blood. OSTalpha efficiently transports the major species of bile acids.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using OSTalpha antibody (70R-4593) | OSTalpha antibody (70R-4593) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors