Osteomodulin antibody (70R-6074)

Rabbit polyclonal Osteomodulin antibody raised against the middle region of OMD

Synonyms Polyclonal Osteomodulin antibody, Anti-Osteomodulin antibody, SLRR2C antibody, OMD antibody, OSAD antibody
Specificity Osteomodulin antibody was raised against the middle region of OMD
Cross Reactivity Human, Mouse
Applications WB
Immunogen Osteomodulin antibody was raised using the middle region of OMD corresponding to a region with amino acids LLQLHLEHNNLEEFPFPLPKSLERLLLGYNEISKLQTNAMDGLVNLTMLD
Assay Information Osteomodulin Blocking Peptide, catalog no. 33R-5180, is also available for use as a blocking control in assays to test for specificity of this Osteomodulin antibody


Western Blot analysis using Osteomodulin antibody (70R-6074)

Osteomodulin antibody (70R-6074) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 49 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of OMD antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance OMD may be implicated in biomineralization processes. Has a function in binding of osteoblasts via the alpha(V)beta(3)-integrin.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Osteomodulin antibody (70R-6074) | Osteomodulin antibody (70R-6074) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors