Otospiralin antibody (70R-4531)

Rabbit polyclonal Otospiralin antibody raised against the N terminal of OTOS

Synonyms Polyclonal Otospiralin antibody, Anti-Otospiralin antibody, OTOSP antibody, OTOS antibody
Specificity Otospiralin antibody was raised against the N terminal of OTOS
Cross Reactivity Human
Applications WB
Immunogen Otospiralin antibody was raised using the N terminal of OTOS corresponding to a region with amino acids MQACMVPGLALCLLLGPLAGAKPVQEEGDPYAELPAMPYWPFSTSDFWNY
Assay Information Otospiralin Blocking Peptide, catalog no. 33R-6316, is also available for use as a blocking control in assays to test for specificity of this Otospiralin antibody

Images

Western Blot analysis using Otospiralin antibody (70R-4531)

Otospiralin antibody (70R-4531) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 10 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of OTOS antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance OTOS may be essential for the survival of the neurosensory epithelium of the inner ear.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Otospiralin antibody (70R-4531) | Otospiralin antibody (70R-4531) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors