OTUB1 antibody (70R-3802)

Rabbit polyclonal OTUB1 antibody raised against the N terminal of OTUB1

Synonyms Polyclonal OTUB1 antibody, Anti-OTUB1 antibody, FLJ20113 antibody, OTUB 1, OTUB1, FLJ40710 antibody, OTU1 antibody, MGC111158 antibody, Otu Domain Ubiquitin Aldehyde Binding 1 antibody, MGC4584 antibody, OTUB-1, OTB1 antibody, HSPC263 antibody, OTUB-1 antibody, OTUB 1 antibody
Specificity OTUB1 antibody was raised against the N terminal of OTUB1
Cross Reactivity Human
Applications WB
Immunogen OTUB1 antibody was raised using the N terminal of OTUB1 corresponding to a region with amino acids DRIQQEIAVQNPLVSERLELSVLYKEYAEDDNIYQQKIKDLHKKYSYIRK
Assay Information OTUB1 Blocking Peptide, catalog no. 33R-2145, is also available for use as a blocking control in assays to test for specificity of this OTUB1 antibody


Western Blot analysis using OTUB1 antibody (70R-3802)

OTUB1 antibody (70R-3802) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 31 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of OTUB1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The product of this gene is a member of the OTU (ovarian tumor) superfamily of predicted cysteine proteases. The encoded protein is a highly specific ubiquitin iso-peptidase, and cleaves ubiquitin from branched poly-ubiquitin chains but not from ubiquitin.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using OTUB1 antibody (70R-3802) | OTUB1 antibody (70R-3802) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors