OTUD6B antibody (70R-5812)

Rabbit polyclonal OTUD6B antibody raised against the middle region of OTUD6B

Synonyms Polyclonal OTUD6B antibody, Anti-OTUD6B antibody, OTUDB 6 antibody, OTUDB 6, duba5 antibody, CGI-77 antibody, OTUDB-6, OTUD6B, OTUDB-6 antibody, Otu Domain Containing 6B antibody
Specificity OTUD6B antibody was raised against the middle region of OTUD6B
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen OTUD6B antibody was raised using the middle region of OTUD6B corresponding to a region with amino acids EIIQADSPPIIVGEEYSKKPLILVYMRHAYGLGEHYNSVTRLVNIVTENC
Assay Information OTUD6B Blocking Peptide, catalog no. 33R-2473, is also available for use as a blocking control in assays to test for specificity of this OTUD6B antibody

Images

Western Blot analysis using OTUD6B antibody (70R-5812)

OTUD6B antibody (70R-5812) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of OTUD6B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Deubiquitinating enzymes are proteases that specifically cleave ubiquitin linkages, negating the action of ubiquitin ligases. DUBA5 belongs to a DUB subfamily characterized by an ovarian tumor (OTU) domain.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using OTUD6B antibody (70R-5812) | OTUD6B antibody (70R-5812) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors