OXCT1 antibody (70R-5319)

Rabbit polyclonal OXCT1 antibody raised against the N terminal of OXCT1

Synonyms Polyclonal OXCT1 antibody, Anti-OXCT1 antibody, OXCT 1 antibody, OXCT1, OXCT-1 antibody, OXCT antibody, OXCT 1, SCOT antibody, 3-Oxoacid Coa Transferase 1 antibody, OXCT-1
Specificity OXCT1 antibody was raised against the N terminal of OXCT1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen OXCT1 antibody was raised using the N terminal of OXCT1 corresponding to a region with amino acids TLAERIRAGGAGVPAFYTPTGYGTLVQEGGSPIKYNKDGSVAIASKPREV
Assay Information OXCT1 Blocking Peptide, catalog no. 33R-9158, is also available for use as a blocking control in assays to test for specificity of this OXCT1 antibody

Images

Western Blot analysis using OXCT1 antibody (70R-5319)

OXCT1 antibody (70R-5319) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of OXCT1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance OXCT1 is a member of the 3-oxoacid CoA-transferase gene family. It is a homodimeric mitochondrial matrix enzyme that plays a central role in extrahepatic ketone body catabolism by catalyzing the reversible transfer of coenzyme A from succinyl-CoA to acetoacetate.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using OXCT1 antibody (70R-5319) | OXCT1 antibody (70R-5319) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors