P2RX2 antibody (70R-5171)

Rabbit polyclonal P2RX2 antibody raised against the N terminal of P2RX2

Synonyms Polyclonal P2RX2 antibody, Anti-P2RX2 antibody, Purinergic Receptor P2X Ligand-Gated Ion Channel 2 antibody, PRX 2, PRX-2, PRX-2 antibody, P2RX2, PRX 2 antibody
Specificity P2RX2 antibody was raised against the N terminal of P2RX2
Cross Reactivity Human
Applications WB
Immunogen P2RX2 antibody was raised using the N terminal of P2RX2 corresponding to a region with amino acids VVRNRRLGVLYRAVQLLILLYFVWYVFIVQKSYQESETGPESSIITKVKG
Assay Information P2RX2 Blocking Peptide, catalog no. 33R-9891, is also available for use as a blocking control in assays to test for specificity of this P2RX2 antibody


Western Blot analysis using P2RX2 antibody (70R-5171)

P2RX2 antibody (70R-5171) used at 0.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 44 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of P2RX2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The product of P2RX2 belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel. Binding to ATP mediates synaptic transmission between neurons and from neurons to smooth muscle.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using P2RX2 antibody (70R-5171) | P2RX2 antibody (70R-5171) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors