P2RX4 antibody (70R-5172)

Rabbit polyclonal P2RX4 antibody raised against the N terminal of P2RX4

Synonyms Polyclonal P2RX4 antibody, Anti-P2RX4 antibody, P2X4 antibody, P2RX4, PRX4 2 antibody, PRX4-2 antibody, PRX4 2, Purinergic Receptor P2X Ligand-Gated Ion Channel 4 antibody, P2X4R antibody, PRX4-2
Specificity P2RX4 antibody was raised against the N terminal of P2RX4
Cross Reactivity Human
Applications WB
Immunogen P2RX4 antibody was raised using the N terminal of P2RX4 corresponding to a region with amino acids VQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKVKGVAVTNTSKLGFRIW
Assay Information P2RX4 Blocking Peptide, catalog no. 33R-9751, is also available for use as a blocking control in assays to test for specificity of this P2RX4 antibody

Images

Western Blot analysis using P2RX4 antibody (70R-5172)

P2RX4 antibody (70R-5172) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of P2RX4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel with high calcium permeability. The main pharmacological distinction between the members of the purinoceptor family is the relative sensitivity to the antagonists suramin and PPADS.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using P2RX4 antibody (70R-5172) | P2RX4 antibody (70R-5172) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors