P2RX7 antibody (70R-5124)

Rabbit polyclonal P2RX7 antibody raised against the middle region of P2RX7

Synonyms Polyclonal P2RX7 antibody, Anti-P2RX7 antibody, P2X7 antibody, MGC20089 antibody, PRX7 2, PRX7-2, Purinergic Receptor P2X Ligand-Gated Ion Channel 7 antibody, PRX7 2 antibody, PRX7-2 antibody, P2RX7
Specificity P2RX7 antibody was raised against the middle region of P2RX7
Cross Reactivity Human
Applications WB
Immunogen P2RX7 antibody was raised using the middle region of P2RX7 corresponding to a region with amino acids LRHCAYRCYATWRFGSQDMADFANLPSCCRWRIRKEFPKSEGQYSGFKSP
Assay Information P2RX7 Blocking Peptide, catalog no. 33R-5361, is also available for use as a blocking control in assays to test for specificity of this P2RX7 antibody

Images

Western Blot analysis using P2RX7 antibody (70R-5124)

P2RX7 antibody (70R-5124) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 68 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of P2RX7 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The product P2RX7 belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel and is responsible for ATP-dependent lysis of macrophages through the formation of membrane pores permeable to large molecules. Activation of this nuclear receptor by ATP in the cytoplasm may be a mechanism by which cellular activity can be coupled to changes in gene expression.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using P2RX7 antibody (70R-5124) | P2RX7 antibody (70R-5124) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors