P2RXL1 antibody (70R-5141)

Rabbit polyclonal P2RXL1 antibody raised against the N terminal of P2RXL1

Synonyms Polyclonal P2RXL1 antibody, Anti-P2RXL1 antibody, P2RXL1, PRXL1 2 antibody, PRXL1 2, PRXL1-2, Purinergic Receptor P2X-Like 1 Orphan Receptor antibody, PRXL1-2 antibody
Specificity P2RXL1 antibody was raised against the N terminal of P2RXL1
Cross Reactivity Human
Applications WB
Immunogen P2RXL1 antibody was raised using the N terminal of P2RXL1 corresponding to a region with amino acids ERDLEPQFSIITKLKGVSVTQIKELGNRLWDVADFVKPPQGENVFFLVTN
Assay Information P2RXL1 Blocking Peptide, catalog no. 33R-2688, is also available for use as a blocking control in assays to test for specificity of this P2RXL1 antibody

Images

Western Blot analysis using P2RXL1 antibody (70R-5141)

P2RXL1 antibody (70R-5141) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of P2RXL1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance P2RXL1 encodes a protein in the family of P2X receptors, which are ATP-gated ion channels and mediate rapid and selective permeability to cations. P2RXL1 is predominantly expressed in skeletal muscle, and regulated by p53. The encoded protein is associated with VE-cadherin at the adherens junctions of human umbilical vein endothelial cells.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using P2RXL1 antibody (70R-5141) | P2RXL1 antibody (70R-5141) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors