P2RY12 antibody (70R-7094)

Rabbit polyclonal P2RY12 antibody raised against the N terminal of P2RY12

Synonyms Polyclonal P2RY12 antibody, Anti-P2RY12 antibody, P2Y(AC) antibody, HORK3 antibody, P2T(AC) antibody, P2Y(ADP) antibody, P2RY12, PRY1 2 antibody, P2Y12 antibody, PRY1-2, PRY1 2, SP1999 antibody, PRY1-2 antibody, ADPG-R antibody, P2Y(cyc) antibody, Purinergic Receptor P2Y G-Protein Coupled 12 antibody
Specificity P2RY12 antibody was raised against the N terminal of P2RY12
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen P2RY12 antibody was raised using the N terminal of P2RY12 corresponding to a region with amino acids VAIWMFVFHMKPWSGISVYMFNLALADFLYVLTLPALIFYYFNKTDWIFG
Assay Information P2RY12 Blocking Peptide, catalog no. 33R-9419, is also available for use as a blocking control in assays to test for specificity of this P2RY12 antibody

Images

Western Blot analysis using P2RY12 antibody (70R-7094)

P2RY12 antibody (70R-7094) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of P2RY12 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance P2RY12 belongs to the family of G-protein coupled receptors. This family has several receptor subtypes with different pharmacological selectivity, which overlaps in some cases, for various adenosine and uridine nucleotides. This receptor is involved in platelets aggregation, and is a potential target for the treatment of thromboembolisms and other clotting disorders.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using P2RY12 antibody (70R-7094) | P2RY12 antibody (70R-7094) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors