P4HB antibody (70R-5389)

Rabbit polyclonal P4HB antibody raised against the N terminal of P4HB

Synonyms Polyclonal P4HB antibody, Anti-P4HB antibody, PROHB antibody, PHB 4, GIT antibody, PO4DB antibody, DSI antibody, P4HB, PHB 4 antibody, Procollagen-Proline 2-Oxoglutarate 4-Dioxygenase Beta Polypeptide antibody, ERBA2L antibody, PHB-4, PDIA1 antibody, PO4HB antibody, PDI antibody, PHB-4 antibody, PHDB antibody
Specificity P4HB antibody was raised against the N terminal of P4HB
Cross Reactivity Human,Mouse,Rat
Applications IHC, WB
Immunogen P4HB antibody was raised using the N terminal of P4HB corresponding to a region with amino acids TIKFFRNGDTASPKEYTAGREADDIVNWLKKRTGPAATTLPDGAAAESLV
Assay Information P4HB Blocking Peptide, catalog no. 33R-9118, is also available for use as a blocking control in assays to test for specificity of this P4HB antibody

Images

Immunohistochemical staining using P4HB antibody (70R-5389)

P4HB antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 55 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of P4HB antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance P4HB is the beta subunit of prolyl 4-hydroxylase, a highly abundant multifunctional enzyme that belongs to the protein disulfide isomerase family. When present as a tetramer consisting of two alpha and two beta subunits, this enzyme is involved in hydroxylation of prolyl residues in preprocollagen. This enzyme is also a disulfide isomerase containing two thioredoxin domains that catalyze the formation, breakage and rearrangement of disulfide bonds. Other known functions include its ability to act as a chaperone that inhibits aggregation of misfolded proteins in a concentration-dependent manner, its ability to bind thyroid hormone, its role in both the influx and efflux of S-nitrosothiol-bound nitric oxide, and its function as a subunit of the microsomal triglyceride transfer protein complex.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using P4HB antibody (70R-5389) | P4HB antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using P4HB antibody (70R-5389) | P4HB antibody (70R-5389) used at 0.5 ug/ml to detect target protein.
  • Immunohistochemical staining using P4HB antibody (70R-5389) | P4HB antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Availability: In stock

Price: $375.00
Size: 50 ug
OR
Shipping
View Our Distributors