P4HB antibody (70R-5394)

Rabbit polyclonal P4HB antibody raised against the C terminal of P4HB

Synonyms Polyclonal P4HB antibody, Anti-P4HB antibody, Procollagen-Proline 2-Oxoglutarate 4-Dioxygenase Beta Polypeptide antibody, PROHB antibody, PHB-4, PO4DB antibody, PHB-4 antibody, PDIA1 antibody, PHB 4, PHDB antibody, P4HB, PO4HB antibody, ERBA2L antibody, DSI antibody, GIT antibody, PDI antibody, PHB 4 antibody
Specificity P4HB antibody was raised against the C terminal of P4HB
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen P4HB antibody was raised using the C terminal of P4HB corresponding to a region with amino acids DRTVIDYNGERTLDGFKKFLESGGQDGAGDDDDLEDLEEAEEPDMEEDDD
Assay Information P4HB Blocking Peptide, catalog no. 33R-2152, is also available for use as a blocking control in assays to test for specificity of this P4HB antibody


Western Blot analysis using P4HB antibody (70R-5394)

P4HB antibody (70R-5394) used at 0.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 55 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of P4HB antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance P4HB is the beta subunit of prolyl 4-hydroxylase, a highly abundant multifunctional enzyme that belongs to the protein disulfide isomerase family. When present as a tetramer consisting of two alpha and two beta subunits, this enzyme is involved in hydroxylation of prolyl residues in preprocollagen. This enzyme is also a disulfide isomerase containing two thioredoxin domains that catalyze the formation, breakage and rearrangement of disulfide bonds. Other known functions include its ability to act as a chaperone that inhibits aggregation of misfolded proteins in a concentration-dependent manner, its ability to bind thyroid hormone, its role in both the influx and efflux of S-nitrosothiol-bound nitric oxide, and its function as a subunit of the microsomal triglyceride transfer protein complex.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using P4HB antibody (70R-5394) | P4HB antibody (70R-5394) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors