PABPC4 antibody (70R-4874)

Rabbit polyclonal PABPC4 antibody raised against the middle region of PABPC4

Synonyms Polyclonal PABPC4 antibody, Anti-PABPC4 antibody, APP-1 antibody, PABP4 antibody, PABPC-4 antibody, APP1 antibody, PABPC-4, PABPC 4, Poly A binding protein 4 antibody, iPABP antibody, PABPC4, PABPC 4 antibody
Specificity PABPC4 antibody was raised against the middle region of PABPC4
Cross Reactivity Human
Applications WB
Immunogen PABPC4 antibody was raised using the middle region of PABPC4 corresponding to a region with amino acids RPNPRWQQGGRPQGFQGMPSAIRQSGPRPTLRHLAPTGSECPDRLAMDFG
Assay Information PABPC4 Blocking Peptide, catalog no. 33R-8097, is also available for use as a blocking control in assays to test for specificity of this PABPC4 antibody

Images

Western Blot analysis using PABPC4 antibody (70R-4874)

PABPC4 antibody (70R-4874) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 71 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PABPC4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Poly(A)-binding proteins (PABPs) bind to the poly(A) tail present at the 3-prime ends of most eukaryotic mRNAs. PABPC4 or IPABP (inducible PABP) was isolated as an activation-induced T-cell mRNA encoding a protein. Activation of T cells increased PABPC4 mRNA levels in T cells approximately 5-fold. PABPC4 contains 4 RNA-binding domains and proline-rich C terminus. PABPC4 is localized primarily to the cytoplasm. It is suggested that PABPC4 might be necessary for regulation of stability of labile mRNA species in activated T cells. PABPC4 was also identified as an antigen, APP1 (activated-platelet protein-1), expressed on thrombin-activated rabbit platelets.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PABPC4 antibody (70R-4874) | PABPC4 antibody (70R-4874) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors