PADI4 antibody (70R-3322)

Rabbit polyclonal PADI4 antibody raised against the middle region of PADI4

Synonyms Polyclonal PADI4 antibody, Anti-PADI4 antibody, PADI5 antibody, PADI-4 antibody, PAD antibody, PADI 4 antibody, Peptidyl Arginine Deiminase Type Iv antibody, PDI5 antibody, PDI4 antibody, PADI4, PADI-4, PADI 4
Specificity PADI4 antibody was raised against the middle region of PADI4
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PADI4 antibody was raised using the middle region of PADI4 corresponding to a region with amino acids TGGISGLDSFGNLEVSPPVTVRGKEYPLGRILFGDSCYPSNDSRQMHQAL
Assay Information PADI4 Blocking Peptide, catalog no. 33R-9085, is also available for use as a blocking control in assays to test for specificity of this PADI4 antibody

Images

Western Blot analysis using PADI4 antibody (70R-3322)

PADI4 antibody (70R-3322) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 74 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PADI4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PADI4 is an enzyme responsible for the conversion of arginine residues to citrulline residues. This protein may play a role in granulocyte and macrophage development leading to inflammation and immune response.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PADI4 antibody (70R-3322) | PADI4 antibody (70R-3322) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors