PAFAH1B1 antibody (70R-5659)

Rabbit polyclonal PAFAH1B1 antibody raised against the N terminal of PAFAH1B1

Synonyms Polyclonal PAFAH1B1 antibody, Anti-PAFAH1B1 antibody, PAFAH1B1, LIS1 antibody, PAFAH antibody, PAFAHB-1, PAFAHB-1 antibody, LIS2 antibody, PAFAHB 1 antibody, PAFAHB 1, Platelet-Activating Factor Acetylhydrolase Isoform Ib Alpha Subunit 45Kda antibody, MDCR antibody, MDS antibody
Specificity PAFAH1B1 antibody was raised against the N terminal of PAFAH1B1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PAFAH1B1 antibody was raised using the N terminal of PAFAH1B1 corresponding to a region with amino acids MVLSQRQRDELNRAIADYLRSNGYEEAYSVFKKEAELDVNEELDKKYAGL
Assay Information PAFAH1B1 Blocking Peptide, catalog no. 33R-6595, is also available for use as a blocking control in assays to test for specificity of this PAFAH1B1 antibody


Western Blot analysis using PAFAH1B1 antibody (70R-5659)

PAFAH1B1 antibody (70R-5659) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PAFAH1B1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This locus was identified as encoding a gene that when mutated or lost caused the lissencephaly associated with Miller-Dieker lissencephaly syndrome. PAFAH1B1 is the non-catalytic alpha subunit of the intracellular Ib isoform of platelet-activating factor acteylhydrolase, a heterotrimeric enzyme that specifically catalyzes the removal of the acetyl group at the SN-2 position of platelet-activating factor (identified as 1-O-alkyl-2-acetyl-sn-glyceryl-3-phosphorylcholine).

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PAFAH1B1 antibody (70R-5659) | PAFAH1B1 antibody (70R-5659) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors