PAFAH1B2 antibody (70R-3207)

Rabbit polyclonal PAFAH1B2 antibody raised against the N terminal of PAFAH1B2

Synonyms Polyclonal PAFAH1B2 antibody, Anti-PAFAH1B2 antibody, PAFAHB2-1 antibody, PAFAHB2-1, PAFAHB2 1 antibody, PAFAH1B2, Platelet-Activating Factor Acetylhydrolase Isoform Ib Beta Subunit 30Kda antibody, PAFAHB2 1
Specificity PAFAH1B2 antibody was raised against the N terminal of PAFAH1B2
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen PAFAH1B2 antibody was raised using the N terminal of PAFAH1B2 corresponding to a region with amino acids MSQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMV
Assay Information PAFAH1B2 Blocking Peptide, catalog no. 33R-6478, is also available for use as a blocking control in assays to test for specificity of this PAFAH1B2 antibody

Images

Western Blot analysis using PAFAH1B2 antibody (70R-3207)

PAFAH1B2 antibody (70R-3207) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 25 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PAFAH1B2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Platelet-activating factor acetylhydrolase (PAFAH) inactivates platelet-activating factor (PAF) into acetate and LYSO-PAF.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PAFAH1B2 antibody (70R-3207) | PAFAH1B2 antibody (70R-3207) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors