PAGE4 antibody (70R-4588)

Rabbit polyclonal PAGE4 antibody

Synonyms Polyclonal PAGE4 antibody, Anti-PAGE4 antibody, JM27 antibody, PAGE-4 antibody, PAGE-1 antibody, PAGE-4, PAGE 4, PAGE-4 antibody, GAGEC1 antibody, GAGE-9 antibody, PAGE 4 antibody, PAGE4, P Antigen Family Member 4 antibody, FLJ35184 antibody
Cross Reactivity Human
Applications WB
Immunogen PAGE4 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPIEERKVEGDCQEMDLEKTRSERGDGSDVKEKTPPNPKHAKTKEAGDGQ
Assay Information PAGE4 Blocking Peptide, catalog no. 33R-7259, is also available for use as a blocking control in assays to test for specificity of this PAGE4 antibody


Western Blot analysis using PAGE4 antibody (70R-4588)

PAGE4 antibody (70R-4588) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 11 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PAGE4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is a member of the GAGE family. The GAGE genes are expressed in a variety of tumors and in some fetal and reproductive tissues. This gene is strongly expressed in prostate and prostate cancer, but is also expressed in other male and female reproductive tissues including testis, fallopian tube, uterus, and placenta, as well as in testicular cancer and uterine cancer. The protein encoded by this gene shares sequence similarity with other GAGE/PAGE proteins, and also belongs to a family of CT (cancer-testis) antigens.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PAGE4 antibody (70R-4588) | PAGE4 antibody (70R-4588) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors