PAICS antibody (70R-3667)

Rabbit polyclonal PAICS antibody raised against the N terminal of PAICS

Synonyms Polyclonal PAICS antibody, Anti-PAICS antibody, PAIS antibody, MGC5024 antibody, ADE2 antibody, Phosphoribosylaminoimidazole Carboxylase Phosphoribosylaminoimidazole Succinocarboxamide Synthetase antibody, DKFZp781N1372 antibody, AIRC antibody, MGC1343 antibody, ADE2H1 antibody
Specificity PAICS antibody was raised against the N terminal of PAICS
Cross Reactivity Human,Mouse
Applications WB
Immunogen PAICS antibody was raised using the N terminal of PAICS corresponding to a region with amino acids ATAEVLNIGKKLYEGKTKEVYELLDSPGKVLLQSKDQITAGNAARKNHLE
Assay Information PAICS Blocking Peptide, catalog no. 33R-1547, is also available for use as a blocking control in assays to test for specificity of this PAICS antibody


Western Blot analysis using PAICS antibody (70R-3667)

PAICS antibody (70R-3667) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PAICS antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PAICS is a bifunctional enzyme containing phosphoribosylaminoimidazole carboxylase activity in its N-terminal region and phosphoribosylaminoimidazole succinocarboxamide synthetase in its C-terminal region. It catalyzes steps 6 and 7 of purine biosynthesis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PAICS antibody (70R-3667) | PAICS antibody (70R-3667) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors