Pannexin 3 antibody (70R-7072)

Rabbit polyclonal Pannexin 3 antibody raised against the middle region of PANX3

Synonyms Polyclonal Pannexin 3 antibody, Anti-Pannexin 3 antibody, Pannexin -3, Pannexin 3, Pannexin -3 antibody, Pannexin 3 antibody, Pannexin 3, PANX3 antibody
Specificity Pannexin 3 antibody was raised against the middle region of PANX3
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Pannexin 3 antibody was raised using the middle region of PANX3 corresponding to a region with amino acids IISELDKSYNRSIRLVQHMLKIRQKSSDPYVFWNELEKARKERYFEFPLL
Assay Information Pannexin 3 Blocking Peptide, catalog no. 33R-4008, is also available for use as a blocking control in assays to test for specificity of this Pannexin 3 antibody

Images

Western Blot analysis using Pannexin 3 antibody (70R-7072)

Pannexin 3 antibody (70R-7072) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PANX3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene belongs to the innexin family. Innexin family members are known to be the structural components of gap junctions.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Pannexin 3 antibody (70R-7072) | Pannexin 3 antibody (70R-7072) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors