PARD3 antibody (70R-5678)

Rabbit polyclonal PARD3 antibody

Synonyms Polyclonal PARD3 antibody, Anti-PARD3 antibody, Baz antibody, SE2-5LT1 antibody, SE2-5L16 antibody, PARD 3, FLJ21015 antibody, PAR3alpha antibody, ASIP antibody, SE2-5T2 antibody, Bazooka antibody, Par-3 Partitioning Defective 3 Homolog antibody, PARD3, PARD-3, PARD3A antibody, PARD-3 antibody, PARD 3 antibody, PAR3 antibody
Cross Reactivity Human
Applications WB
Immunogen PARD3 antibody was raised using a synthetic peptide corresponding to a region with amino acids EQQMKKQPPSEGPSNYDSYKKVQDPSYAPPKGPFRQDVPPSPSQVARLNR
Assay Information PARD3 Blocking Peptide, catalog no. 33R-2675, is also available for use as a blocking control in assays to test for specificity of this PARD3 antibody

Images

Western Blot analysis using PARD3 antibody (70R-5678)

PARD3 antibody (70R-5678) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 151 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PARD3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PARD proteins, which were first identified in C. elegans, are essential for asymmetric cell division and polarized growth, whereas CDC42 mediates the establishment of cell polarity. The CDC42 GTPase, which is controlled by nucleotide exchange.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PARD3 antibody (70R-5678) | PARD3 antibody (70R-5678) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors