PARL antibody (70R-6398)

Rabbit polyclonal PARL antibody raised against the N terminal of PARL

Synonyms Polyclonal PARL antibody, Anti-PARL antibody, PSENIP2 antibody, PSARL antibody, Presenilin Associated Rhomboid-Like antibody, PSARL1 antibody, RHBDS1 antibody, PRO2207 antibody
Specificity PARL antibody was raised against the N terminal of PARL
Cross Reactivity Human, Mouse, Rat, Dog
Applications IHC, WB
Immunogen PARL antibody was raised using the N terminal of PARL corresponding to a region with amino acids SLIKPLFFTVGFTGCAFGSAAIWQYESLKSRVQSYFDGIKADWLDSIRPQ
Assay Information PARL Blocking Peptide, catalog no. 33R-8594, is also available for use as a blocking control in assays to test for specificity of this PARL antibody

Images

Immunohistochemical staining using PARL antibody (70R-6398)

PARL antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PARL antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PARL is a mitochondrial integral membrane protein. Following proteolytic processing of this protein, a small peptide (P-beta) is formed and translocated to the nucleus. PARL may be involved in signal transduction via regulated intramembrane proteolysis of membrane-tethered precursor proteins. Variation in its gene has been associated with increased risk for type 2 diabetes.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using PARL antibody (70R-6398) | PARL antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using PARL antibody (70R-6398) | PARL antibody (70R-6398) used at 0.5 ug/ml to detect target protein.
  • Immunohistochemical staining using PARL antibody (70R-6398) | PARL antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors