PARP11 antibody (70R-1285)

Rabbit polyclonal PARP11 antibody

Synonyms Polyclonal PARP11 antibody, Anti-PARP11 antibody, PARP 11, DKFZp779H0122 antibody, PARP 11 antibody, PARP-11, Poly (ADP-ribose) polymerase 11 antibody, PARP-11 antibody, C12orf6 antibody, PARP11, Adp-Ribose Polymerase 11 antibody
Cross Reactivity Human
Applications WB
Immunogen PARP11 antibody was raised using a synthetic peptide corresponding to a region with amino acids SAFSYICENEAIPMPPHWENVNTQVPYQLIPLHNQTHEYNEVANLFGKTM
Assay Information PARP11 Blocking Peptide, catalog no. 33R-8294, is also available for use as a blocking control in assays to test for specificity of this PARP11 antibody


Western Blot analysis using PARP11 antibody (70R-1285)

PARP11 antibody (70R-1285) used at 2.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PARP11 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Poly(ADP-ribosyl)ation is a DNA-damage-dependent post-translational modification of histones. Poly(ADP-ribose) polymerases (PARPs) are a family of 18 proteins, encoded by different genes and displaying a conserved catalytic domain.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PARP11 antibody (70R-1285) | PARP11 antibody (70R-1285) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors