PARP11 antibody (70R-2103)

Rabbit polyclonal PARP11 antibody

Synonyms Polyclonal PARP11 antibody, Anti-PARP11 antibody, PARP11, PARP-11 antibody, PARP 11 antibody, PARP-11, C12orf6 antibody, PARP 11, DKFZp779H0122 antibody, Poly (ADP-ribose) polymerase 11 antibody, Adp-Ribose Polymerase 11 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PARP11 antibody was raised using a synthetic peptide corresponding to a region with amino acids IKHGNTFQIHGVSLQQRHLFRTYKSMFLARVLIGDYINGDSKYMRPPSKD
Assay Information PARP11 Blocking Peptide, catalog no. 33R-4020, is also available for use as a blocking control in assays to test for specificity of this PARP11 antibody

Images

Western Blot analysis using PARP11 antibody (70R-2103)

PARP11 antibody (70R-2103) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PARP11 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PARP1 encodes a chromatin-associated enzyme, poly(ADP-ribosyl)transferase, which modifies various nuclear proteins by poly(ADP-ribosyl)ation. The modification is dependent on DNA and is involved in the regulation of various important cellular processes such as differentiation, proliferation, and tumor transformation and also in the regulation of the molecular events involved in the recovery of cell from DNA damage. In addition, this enzyme may be the site of mutation in Fanconi anemia, and may participate in the pathophysiology of type I diabetes. PARP1 can be cleaved resulting in fragements of 29 and 85 kDa.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PARP11 antibody (70R-2103) | PARP11 antibody (70R-2103) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors