PARP12 antibody (70R-3371)

Rabbit polyclonal PARP12 antibody

Synonyms Polyclonal PARP12 antibody, Anti-PARP12 antibody, MST109 antibody, ZC3H1 antibody, Adp-Ribose Polymerase 12 antibody, Poly (ADP-ribose) polymerase 12 antibody, PARP-12 antibody, PARP-12, PARP 12 antibody, MSTP109 antibody, PARP-12 antibody, ZC3HDC1 antibody, FLJ22693 antibody, PARP12, PARP 12
Cross Reactivity Human
Applications WB
Immunogen PARP12 antibody was raised using a synthetic peptide corresponding to a region with amino acids FYDSCVNSVSDPSIFVIFEKHQVYPEYVIQYTTSSKPSVTPSILLALGSL
Assay Information PARP12 Blocking Peptide, catalog no. 33R-3134, is also available for use as a blocking control in assays to test for specificity of this PARP12 antibody


Western Blot analysis using PARP12 antibody (70R-3371)

PARP12 antibody (70R-3371) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 79 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PARP12 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of PARP12 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PARP12 antibody (70R-3371) | PARP12 antibody (70R-3371) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors