PARP6 antibody (70R-2153)

Rabbit polyclonal PARP6 antibody

Synonyms Polyclonal PARP6 antibody, Anti-PARP6 antibody, PARP-6, MGC131971 antibody, PARP 6, PARP-6 antibody, Poly (ADP-ribose) polymerase 6 antibody, Adp-Ribose Polymerase 6 antibody, PARP 6 antibody, PARP6
Cross Reactivity Human, Mouse, Rat, Dog
Applications IHC, WB
Immunogen PARP6 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLPLSRLKFMHTSHQFLLLSSPPAKEARFRTAKKLYGSTFAFHGSHIENW
Assay Information PARP6 Blocking Peptide, catalog no. 33R-4528, is also available for use as a blocking control in assays to test for specificity of this PARP6 antibody


Western Blot analysis using PARP6 antibody (70R-2153)

PARP6 antibody (70R-2153) used at 0.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 59 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PARP6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Poly(ADP-ribose) polymerases (PARPs) constitute a large family of 18 proteins, encoded by different genes and displaying a conserved catalytic domain. They are involved in DNA-damage-dependent post-translational modification of histones and other nuclear proteins that contributes to the survival of injured proliferating cells.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PARP6 antibody (70R-2153) | PARP6 antibody (70R-2153) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors