PARP6 antibody (70R-2153)

Rabbit polyclonal PARP6 antibody

Synonyms Polyclonal PARP6 antibody, Anti-PARP6 antibody, PARP-6, MGC131971 antibody, PARP 6, PARP-6 antibody, Poly (ADP-ribose) polymerase 6 antibody, Adp-Ribose Polymerase 6 antibody, PARP 6 antibody, PARP6
Cross Reactivity Human, Mouse, Rat, Dog
Applications IHC, WB
Immunogen PARP6 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLPLSRLKFMHTSHQFLLLSSPPAKEARFRTAKKLYGSTFAFHGSHIENW
Assay Information PARP6 Blocking Peptide, catalog no. 33R-4528, is also available for use as a blocking control in assays to test for specificity of this PARP6 antibody

Images

Immunohistochemical staining using PARP6 antibody (70R-2153)

PARP6 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of intestinal villus (arrows) in Human Intestine. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 59 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PARP6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Poly(ADP-ribose) polymerases (PARPs) constitute a large family of 18 proteins, encoded by different genes and displaying a conserved catalytic domain. They are involved in DNA-damage-dependent post-translational modification of histones and other nuclear proteins that contributes to the survival of injured proliferating cells.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using PARP6 antibody (70R-2153) | PARP6 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of intestinal villus (arrows) in Human Intestine. Magnification is at 400X
  • Western Blot analysis using PARP6 antibody (70R-2153) | PARP6 antibody (70R-2153) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors