PARVB antibody (70R-6053)

Rabbit polyclonal PARVB antibody raised against the C terminal of PARVB

Synonyms Polyclonal PARVB antibody, Anti-PARVB antibody, CGI-56 antibody, Parvin Beta antibody
Specificity PARVB antibody was raised against the C terminal of PARVB
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PARVB antibody was raised using the C terminal of PARVB corresponding to a region with amino acids HNVSFAFELMLDGGLKKPKARPEDVVNLDLKSTLRVLYNLFTKYKNVE
Assay Information PARVB Blocking Peptide, catalog no. 33R-3803, is also available for use as a blocking control in assays to test for specificity of this PARVB antibody

Images

Western Blot analysis using PARVB antibody (70R-6053)

PARVB antibody (70R-6053) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PARVB antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Members of the parvin family, including PARVB, are actin-binding proteins associated with focal contacts.Members of the parvin family, including PARVB, are actin-binding proteins associated with focal contacts.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PARVB antibody (70R-6053) | PARVB antibody (70R-6053) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors