PBEF1 antibody (70R-1027)

Rabbit polyclonal PBEF1 antibody raised against the C terminal of PBEF1

Synonyms Polyclonal PBEF1 antibody, Anti-PBEF1 antibody, 1110035O14Rik antibody, PBEF 1 antibody, PBEF-1 antibody, PBEF-1, Pre-B-Cell Colony Enhancing Factor 1 antibody, PBEF antibody, DKFZP666B131 antibody, PBEF 1, MGC117256 antibody, NAMPT antibody, PBEF1
Specificity PBEF1 antibody was raised against the C terminal of PBEF1
Cross Reactivity Human,Mouse,Rat,Dog,ZebraFish
Applications WB
Immunogen PBEF1 antibody was raised using the C terminal of PBEF1 corresponding to a region with amino acids CSYVVTNGLGINVFKDPVADPNKRSKKGRLSLHRTPAGNFVTLEEGKGDL
Assay Information PBEF1 Blocking Peptide, catalog no. 33R-1818, is also available for use as a blocking control in assays to test for specificity of this PBEF1 antibody

Images

Western Blot analysis using PBEF1 antibody (70R-1027)

PBEF1 antibody (70R-1027) used at 2.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 54 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PBEF1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PBEF1 catalyzes the condensation of nicotinamide with 5-phosphoribosyl-1-pyrophosphate to yield nicotinamide mononucleotide, one step in the biosynthesis of nicotinamide adenine dinucleotide. The protein is an adipokine that is localized to the bloodstream and has various functions, including the promotion of vascular smooth muscle cell maturation and inhibition of neutrophil apoptosis. It also activates insulin receptor and has insulin-mimetic effects, lowering blood glucose and improving insulin sensitivity. The protein is highly expressed in visceral fat and serum levels of the protein correlate with obesity.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PBEF1 antibody (70R-1027) | PBEF1 antibody (70R-1027) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors