PBK antibody (70R-5572)

Rabbit polyclonal PBK antibody raised against the N terminal of PBK

Synonyms Polyclonal PBK antibody, Anti-PBK antibody, FLJ14385 antibody, Nori-3 antibody, Pdz Binding Kinase antibody, TOPK antibody, SPK antibody
Specificity PBK antibody was raised against the N terminal of PBK
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PBK antibody was raised using the N terminal of PBK corresponding to a region with amino acids SLCLAMEYGGEKSLNDLIEERYKASQDPFPAAIILKVALNMARGLKYLHQ
Assay Information PBK Blocking Peptide, catalog no. 33R-8581, is also available for use as a blocking control in assays to test for specificity of this PBK antibody


Western Blot analysis using PBK antibody (70R-5572)

PBK antibody (70R-5572) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PBK antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PBK is a serine/threonine kinase related to the dual specific mitogen-activated protein kinase kinase (MAPKK) family. Evidence suggests that mitotic phosphorylation is required for its catalytic activity. This mitotic kinase may be involved in the activation of lymphoid cells and support testicular functions, with a suggested role in the process of spermatogenesis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PBK antibody (70R-5572) | PBK antibody (70R-5572) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors