PBLD antibody (70R-4307)

Rabbit polyclonal PBLD antibody raised against the N terminal of PBLD

Synonyms Polyclonal PBLD antibody, Anti-PBLD antibody, Phenazine Biosynthesis-Like Protein Domain Containing antibody, MAWBP antibody, FLJ35507 antibody, FLJ14767 antibody, MAWDBP antibody
Specificity PBLD antibody was raised against the N terminal of PBLD
Cross Reactivity Human
Applications WB
Immunogen PBLD antibody was raised using the N terminal of PBLD corresponding to a region with amino acids KLPIFIADAFTARAFRGNPAAVCLLENELDEDMHQKIAREMNLSETAFIR
Assay Information PBLD Blocking Peptide, catalog no. 33R-4526, is also available for use as a blocking control in assays to test for specificity of this PBLD antibody

Images

Western Blot analysis using PBLD antibody (70R-4307)

PBLD antibody (70R-4307) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 31 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PBLD antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of the PBLD protein has not been widely studied, and is yet to be fully elucidated.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PBLD antibody (70R-4307) | PBLD antibody (70R-4307) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors