PCBP2 antibody (70R-1378)
Rabbit polyclonal PCBP2 antibody
Overview
Overview
| Synonyms | Polyclonal PCBP2 antibody, Anti-PCBP2 antibody, PCBP 2 antibody, Poly rC binding protein 2 antibody, PCBP-2, PCBP2, PCBP-2 antibody, PCBP 2 |
|---|---|
| Cross Reactivity | Human, Mouse, Rat, Dog |
| Applications | IHC, WB |
| Immunogen | PCBP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VIFAGGQDRYSTGSDSASFPHTTPSMCLNPDLEGPPLEAYTIQGQYAIPQ |
| Assay Information | PCBP2 Blocking Peptide, catalog no. 33R-9591, is also available for use as a blocking control in assays to test for specificity of this PCBP2 antibody |
Images
Immunohistochemical staining using PCBP2 antibody (70R-1378)
PCBP2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Alveolar cells (arrows) in Human Lung. Magnification is at 400X
PCBP2 antibody
Immunohistochemical staining using PCBP2 antibody (70R-1378)
PCBP2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Alveolar cells (arrows) in Human Lung. Magnification is at 400X
Western Blot analysis using PCBP2 antibody (70R-1378)
PCBP2 antibody (70R-1378) used at 1.25 ug/ml to detect target protein.
Specifications
| Host | Rabbit |
|---|---|
| Method of Purification | Total IgG Protein A purified |
| Molecular Weight | 40 kDa (MW of target protein) |
| Form & Buffer | Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PCBP2 antibody in PBS |
| Concentration | 1 mg/ml |
Usage & Assay Information
| Usage Recommendations | WB: 1.25 ug/ml; IHC: 4-8 ug/ml |
|---|
Storage & Safety
| Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | PCBP2 appears to be multifunctional. It along with PCBP-1 and hnRNPK corresponds to the major cellular poly(rC)-binding proteins. This protein together with PCBP-1 also functions as translational coactivators of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES and promote poliovirus RNA replication by binding to its 5'-terminal cloverleaf structure. It has also been implicated in translational control of the 15-lipoxygenase mRNA, human Papillomavirus type 16 L2 mRNA, and hepatitis A virus RNA. The protein is also suggested to play a part in formation of a sequence-specific alpha-globin mRNP complex which is associated with alpha-globin mRNA stability. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product
