PCBP2 antibody (70R-1378)

Rabbit polyclonal PCBP2 antibody

Synonyms Polyclonal PCBP2 antibody, Anti-PCBP2 antibody, PCBP 2 antibody, Poly rC binding protein 2 antibody, PCBP-2, PCBP2, PCBP-2 antibody, PCBP 2
Cross Reactivity Human, Mouse, Rat, Dog
Applications IHC, WB
Immunogen PCBP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VIFAGGQDRYSTGSDSASFPHTTPSMCLNPDLEGPPLEAYTIQGQYAIPQ
Assay Information PCBP2 Blocking Peptide, catalog no. 33R-9591, is also available for use as a blocking control in assays to test for specificity of this PCBP2 antibody

Images

Western Blot analysis using PCBP2 antibody (70R-1378)

PCBP2 antibody (70R-1378) used at 1.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PCBP2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PCBP2 appears to be multifunctional. It along with PCBP-1 and hnRNPK corresponds to the major cellular poly(rC)-binding proteins. This protein together with PCBP-1 also functions as translational coactivators of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES and promote poliovirus RNA replication by binding to its 5'-terminal cloverleaf structure. It has also been implicated in translational control of the 15-lipoxygenase mRNA, human Papillomavirus type 16 L2 mRNA, and hepatitis A virus RNA. The protein is also suggested to play a part in formation of a sequence-specific alpha-globin mRNP complex which is associated with alpha-globin mRNA stability.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PCBP2 antibody (70R-1378) | PCBP2 antibody (70R-1378) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors